PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr017263.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family GRAS
Protein Properties Length: 514aa    MW: 57088.3 Da    PI: 5.1992
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr017263.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS268.13e-8220151162374
         GRAS  62 kalppsetseknsseelaalklfsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRp......eg...ppslRiTgvgsp 150
                  ++ + + ts+ + ++++ a+k fs +sP++ fsh+t+Nqa+lea++g+  +H+iDfdi+ G+Q+++L+++La+++      +g   pp lRiT+v+++
  Pbr017263.1 201 DTAAREFTSWADIVQTIRAHKGFSGISPVPMFSHFTTNQALLEALNGSAFIHVIDFDIGLGGQYASLMKELAEKAdvasrnNGnpvPPVLRITAVVPE 298
                  44455556667799**********************************************************9996655432277899*********6 PP

         GRAS 151 esgskeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqe..a 246
                  e   + e++ ++e+L++fA+el+++f+ +++  ++++++++++ ++  gE++aV l+  + r l+++ +++     +L  ++++sP vvv+v+ e   
  Pbr017263.1 299 E--YAVETRLIRENLSQFAQELKIRFQVEFVPLRTFDMMSFKAVKFMDGEKTAVLLSPYILRRLSSQNNIS----GFLGNMRRVSPSVVVFVDGEgmG 390
                  6..9999***********************9999************************9999995555555....5*******************655 PP

         GRAS 247 dhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkv 344
                  d +++sF + f++ le++s +++sl+a++++ s+  +k+E  ll+++i+  v ++g++          Wre ++ aG+++v+ls++a  qa++ll kv
  Pbr017263.1 391 DAGTTSFRRNFISGLEFFSIMLESLDASVAASSDVVKKIETYLLRPKIQATVEAAGRR-------IPPWREVFQGAGMRAVELSQFADFQAQCLLGKV 481
                  6699****************************************************98.......99******************************* PP

         GRAS 345 ksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                  +++g++v +++++lvl+W+dr+Lv++SaWr
  Pbr017263.1 482 QVRGFHVAKRQAELVLCWHDRALVATSAWR 511
                  *****************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098530.767106491IPR005202Transcription factor GRAS
PfamPF035141.0E-79201511IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0030154Biological Processcell differentiation
GO:0048831Biological Processregulation of shoot system development
Sequence ? help Back to Top
Protein Sequence    Length: 514 aa     Download sequence    Send to blast
MRVPVSSPLS NNDNQSPKHN PQSNNPSVNF HLGISSLGGY EPTSVLDLRQ SPSPVSAEKP  60
SKISGISNVL SHSNHDPLEW EDEQVLHNLD WDSIMRDLGL HDDNVPNLKT SIPQLNANDP  120
QISEYPHPQQ FDPTQLVHSD YDINLSEVYS SQNCYDHVTN DFHPSGNWNV GLDFIEELIR  180
AADCFDTEEL QLAQSLLNGS DTAAREFTSW ADIVQTIRAH KGFSGISPVP MFSHFTTNQA  240
LLEALNGSAF IHVIDFDIGL GGQYASLMKE LAEKADVASR NNGNPVPPVL RITAVVPEEY  300
AVETRLIREN LSQFAQELKI RFQVEFVPLR TFDMMSFKAV KFMDGEKTAV LLSPYILRRL  360
SSQNNISGFL GNMRRVSPSV VVFVDGEGMG DAGTTSFRRN FISGLEFFSI MLESLDASVA  420
ASSDVVKKIE TYLLRPKIQA TVEAAGRRIP PWREVFQGAG MRAVELSQFA DFQAQCLLGK  480
VQVRGFHVAK RQAELVLCWH DRALVATSAW RCN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A5e-1822051180375GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009374236.10.0PREDICTED: scarecrow-like protein 15
SwissprotO232101e-145SCL15_ARATH; Scarecrow-like protein 15
TrEMBLM5VV560.0M5VV56_PRUPE; Uncharacterized protein
STRINGPOPTR_0005s12730.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF59593252
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36710.11e-142GRAS family protein